What is the catalog number for KLHDC10 Peptide - C-terminal region?

The catalog number for KLHDC10 Peptide - C-terminal region is orb2003134.

What sizes are available for KLHDC10 Peptide - C-terminal region?

KLHDC10 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is KLHDC10 Peptide - C-terminal region in stock?

KLHDC10 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

KLHDC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLHDC10, KIAA0265

UniProt

Q6PID8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSTDLHKLDLNTREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

426651-01 1 mg

3-Sialyl-D-galactose (α/β mixture)

Sign In for Pricing

View Details

426651-02 10 mg

3-Sialyl-D-galactose (α/β mixture)

Sign In for Pricing

View Details

481154 100 µL

FLYWCH1 (FLYWCH-Type Zinc Finger-Containing Protein 1, FLYWCH-Type Zinc Finger 1)

Sign In for Pricing

View Details

MR200189 10 µg

Bola2 (NM_175103) Mouse Tagged ORF Clone

Sign In for Pricing

View Details

AMM14885V 100 µL

PCNA Mouse Monoclonal Antibody [Clone ID: LBI3F3]

Sign In for Pricing

View Details

GTR10363863 96 Well

Monkey FUN14 domain containing protein 2 (FUNDC2) ELISA Kit

Sign In for Pricing

View Details