Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9 Peptide - middle region

S100A9 Peptide - middle region

Product Specifications

Product Name Alternative

S100A9, CAGB, CFAG, MRP14

UniProt

P06702

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A9 Rabbit Polyclonal Antibody (orb330859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002956

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cxcr3 Mouse Gene Knockout Kit (CRISPR)
KN304051LP 1 Kit

Cxcr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Nitroaniline-2,3,5,6-D4
TRC-N491772-250MG 250 mg

4-Nitroaniline-2,3,5,6-D4

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
TAZ (NM_000116) Human Over-expression Lysate
LY400038 100 µg

TAZ (NM_000116) Human Over-expression Lysate

Sign In for Pricing
View Details
MR1 Human Gene Knockout Kit (CRISPR)
KN220474 1 Kit

MR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details