Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROX1 Peptide - middle region

PROX1 Peptide - middle region

Product Specifications

Product Name Alternative

PROX1

UniProt

Q92786

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROX1 Rabbit Polyclonal Antibody (orb587901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002754

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF568 conjugate, 0.1mg/mL
BNC682257-100 1x 100 µL

Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF488A conjugate, 0.1mg/mL
BNC881782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAT1A (N-term) Rabbit Polyclonal Antibody
AP52613PU-N 400 µL

MAT1A (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560266 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Cefodizime Sodium
TRC-C242883-3G 3 g

Cefodizime Sodium

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560845 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details