PROX1 Peptide - middle region
PROX1 Peptide - middle region
Product Specifications
Product Name Alternative
PROX1
UniProt
Q92786
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PROX1 Rabbit Polyclonal Antibody (orb587901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002754
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681620-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![GNAQ Rabbit Monoclonal Antibody [Clone ID: 23GB1295]](https://cdn.genprice.uk/products/937/6868c300994c49e6dc3ecded/imageurl/ta424789.webp)
TA424789 100 µL
GNAQ Rabbit Monoclonal Antibody [Clone ID: 23GB1295]
Sign In for Pricing
View Details 
BNC683242-500 1x 500 µL
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3242), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Tide Quencher™ 2 succinimidyl ester [TQ2 SE]](https://cdn.genprice.uk/products/271/7359063/imageurl/2210-aat.webp)
BNC940429-500 1x 500 µL
CD19 (CVID3/429), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details