Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF6 Peptide - C-terminal region

ARF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARF6

UniProt

Q6FH17

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARF6 Rabbit Polyclonal Antibody (orb587865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

U1A (SNRPA) Rabbit Polyclonal Antibody
TA369764 100 µL

U1A (SNRPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF405S conjugate, 0.1mg/mL
BNC043566-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]
CF812757 100 µg

PSMA1 Mouse Monoclonal Antibody [Clone ID: OTI9H1]

Sign In for Pricing
View Details
Rhod-4™ maleimide
21127-AAT 100 µg

Rhod-4™ maleimide

Sign In for Pricing
View Details
TMCO7 (TANGO6) Human Gene Knockout Kit (CRISPR)
KN424392 1 Kit

TMCO7 (TANGO6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn2r89 Mouse Gene Knockout Kit (CRISPR)
KN519221 1 Kit

Vmn2r89 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details