Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF6 Peptide - C-terminal region

ARF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARF6

UniProt

Q6FH17

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARF6 Rabbit Polyclonal Antibody (orb587865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R1B Rabbit Polyclonal Antibody
TA370675 100 µL

PPP2R1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFPT1 (NM_002056) Human Recombinant Protein
TP307225L 1 mg

GFPT1 (NM_002056) Human Recombinant Protein

Sign In for Pricing
View Details
TRH Receptor (TRHR) (NM_003301) Human Over-expression Lysate
LY401138 100 µg

TRH Receptor (TRHR) (NM_003301) Human Over-expression Lysate

Sign In for Pricing
View Details
TSHR Antibody
KC-1984-01 50 μL

TSHR Antibody

Sign In for Pricing
View Details
TSHR Antibody
KC-1984-02 100 µL

TSHR Antibody

Sign In for Pricing
View Details
TSHR Antibody
KC-1984-03 1 mL

TSHR Antibody

Sign In for Pricing
View Details