DUS3L Peptide - middle region
DUS3L Peptide - middle region
Product Specifications
Product Name Alternative
DUS3L
UniProt
K7EJX8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUS3L Rabbit Polyclonal Antibody (orb327207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NKGRPHVKPTNYDKNRTWCRRSWRPAGPSPRPSATAWTKPCSSSCGSARS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
033299-FITC 200 µL
CCDC140, NT (CCDC140, Coiled-coil domain-containing protein 140) (FITC) discontinued
Sign In for Pricing
View Details 
GTR15214464 1 Vial
Lentiviral mouse Trnp1 shRNA (UAS) - Lentiviral mouse Trnp1 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details orb1052575 100 µL
8-OHdG (DNA/RNA Damage) Rabbit Polyclonal Antibody (Cy5.5)
Sign In for Pricing
View Details 
MBS2087838-01 24 Strip Well
Bovine Hemoglobin (HB) Mini Samples ELISA Kit
Sign In for Pricing
View Details