Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADK Peptide - N-terminal region

ADK Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADK

UniProt

P55263

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADK Rabbit Polyclonal Antibody (orb587900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Dihydroxynapthalene-2-carboxylic Acid
TRC-D453500-5G 5 g

3,5-Dihydroxynapthalene-2-carboxylic Acid

Sign In for Pricing
View Details
Human CCDC179 activation kit by CRISPRa
GA119272 1 Kit

Human CCDC179 activation kit by CRISPRa

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF640R conjugate, 0.1mg/mL
BNC401680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACOX3 Polyclonal Antibody
E-AB-14480-01 20 µL

ACOX3 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX3 Polyclonal Antibody
E-AB-14480-02 60 µL

ACOX3 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX3 Polyclonal Antibody
E-AB-14480-03 120 µL

ACOX3 Polyclonal Antibody

Sign In for Pricing
View Details