Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADK Peptide - N-terminal region

ADK Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADK

UniProt

P55263

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADK Rabbit Polyclonal Antibody (orb587900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Rat TF (Tissue Factor) ELISA Kit
E-UNEL-R0010-01 5x 96 Tests

Uncoated Rat TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat TF (Tissue Factor) ELISA Kit
E-UNEL-R0010-02 15x 96 Tests

Uncoated Rat TF (Tissue Factor) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS631972 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Fmoc-Ala TentaGel® S TRT Resin
SA1201.25G 25 g

Fmoc-Ala TentaGel® S TRT Resin

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS700756 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Human MRTFB activation kit by CRISPRa
GA111537 1 Kit

Human MRTFB activation kit by CRISPRa

Sign In for Pricing
View Details