Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC15 Peptide - middle region

DNAJC15 Peptide - middle region

Product Specifications

Product Name Alternative

DNAJC15, DNAJD1, GIG22, HSD18

UniProt

Q9Y5T4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC15 Rabbit Polyclonal Antibody (orb331425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037370

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sex Hormone-Binding Globulin (SHBG) Antibody
abx239923 100 µg

Sex Hormone-Binding Globulin (SHBG) Antibody

Sign In for Pricing
View Details
Human Monoclonal Albumin Antibody (Numab patent anti-HSA) [Biotin]
NBP3-27982B 0.1 mL

Human Monoclonal Albumin Antibody (Numab patent anti-HSA) [Biotin]

Sign In for Pricing
View Details
Rasip1 (NM_001106261) Rat Tagged ORF Clone Lentiviral Particle
RR211340L3V 200 µL

Rasip1 (NM_001106261) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Procollagen III NTerminal Propeptide (PIIINP)
MBS2130270-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Procollagen III NTerminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Procollagen III NTerminal Propeptide (PIIINP)
MBS2130270-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Procollagen III NTerminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Procollagen III NTerminal Propeptide (PIIINP)
MBS2130270-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Procollagen III NTerminal Propeptide (PIIINP)

Sign In for Pricing
View Details