Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC15 Peptide - middle region

DNAJC15 Peptide - middle region

Product Specifications

Product Name Alternative

DNAJC15, DNAJD1, GIG22, HSD18

UniProt

Q9Y5T4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJC15 Rabbit Polyclonal Antibody (orb331425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037370

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal alpha Endosulfine Antibody [PerCP]
NBP3-00273PCP 0.1 mL

Rabbit Polyclonal alpha Endosulfine Antibody [PerCP]

Sign In for Pricing
View Details
Palm2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4223507 1.0 µg DNA

Palm2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
NID2 Rabbit pAb
MBS9145644-01 0.02 mL

NID2 Rabbit pAb

Sign In for Pricing
View Details
NID2 Rabbit pAb
MBS9145644-02 0.1 mL

NID2 Rabbit pAb

Sign In for Pricing
View Details
NID2 Rabbit pAb
MBS9145644-03 5x 0.1 mL

NID2 Rabbit pAb

Sign In for Pricing
View Details
Mouse Olfactory receptor 4F21 (OR4F21) ELISA Kit
MBS7235453-01 48 Well

Mouse Olfactory receptor 4F21 (OR4F21) ELISA Kit

Sign In for Pricing
View Details