Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM5B Peptide - C-terminal region

KDM5B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KDM5B, JARID1B, PLU1, RBBP2H1

UniProt

Q9UGL1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDM5B Rabbit Polyclonal Antibody (orb587950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006609

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXADR (Coxsackievirus And Adenovirus Receptor, CAR, HCAR, CAR4/6) (MaxLight 550)
MBS6413204-01 0.1 mL

CXADR (Coxsackievirus And Adenovirus Receptor, CAR, HCAR, CAR4/6) (MaxLight 550)

Sign In for Pricing
View Details
CXADR (Coxsackievirus And Adenovirus Receptor, CAR, HCAR, CAR4/6) (MaxLight 550)
MBS6413204-02 5x 0.1 mL

CXADR (Coxsackievirus And Adenovirus Receptor, CAR, HCAR, CAR4/6) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-Smad2 (Ser250) Rabbit Polyclonal Antibody (PE-Cy7)
orb954777 100 µL

Phospho-Smad2 (Ser250) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Gpr151 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3611305 3x 1.0 µg

Gpr151 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
GNPAT Antibody
E11-15358C 100 µg

GNPAT Antibody

Sign In for Pricing
View Details
ARHGAP30 (NM_181720) Human 3' UTR Clone
SC210618 10 µg

ARHGAP30 (NM_181720) Human 3' UTR Clone

Sign In for Pricing
View Details