Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5F1D Peptide - middle region

ATP5F1D Peptide - middle region

Product Specifications

Product Name Alternative

ATP5D

UniProt

P30049

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP5F1D Rabbit Polyclonal Antibody (orb588070) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001678

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TRMT112 shRNA (UAS) - Lentiviral human TRMT112 shRNA (UAS, GFP) (100)
GTR15162489 1 Vial

Lentiviral human TRMT112 shRNA (UAS) - Lentiviral human TRMT112 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
JOT-AP03177-01 20 µL

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
JOT-AP03177-02 50 μL

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details
FBN1 Polyclonal Antibody
JOT-AP03177-03 100 µL

FBN1 Polyclonal Antibody

Sign In for Pricing
View Details
Pyrimidine-5-carboxamidine
sc-296155A 1 g

Pyrimidine-5-carboxamidine

Sign In for Pricing
View Details
Lentiviral mouse Slc48a1 shRNA (UAS) - Lentiviral mouse Slc48a1 shRNA (UAS, RFP) (100)
GTR15190560 1 Vial

Lentiviral mouse Slc48a1 shRNA (UAS) - Lentiviral mouse Slc48a1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details