Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5F1D Peptide - middle region

ATP5F1D Peptide - middle region

Product Specifications

Product Name Alternative

ATP5D

UniProt

P30049

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP5F1D Rabbit Polyclonal Antibody (orb588070) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001678

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCP-2 (m) -PR
sc-105329-PR 10 µM - 20 µL

GCP-2 (m) -PR

Sign In for Pricing
View Details
N, N-Dimethyl-m-anisidine
459932-01 10 g

N, N-Dimethyl-m-anisidine

Sign In for Pricing
View Details
N, N-Dimethyl-m-anisidine
459932-02 25 g

N, N-Dimethyl-m-anisidine

Sign In for Pricing
View Details
ONO 2506
4530/10 10 mg

ONO 2506

Sign In for Pricing
View Details
2,4-Dibromo-5-fluorochlorobenzene
sc-322057A 5 g

2,4-Dibromo-5-fluorochlorobenzene

Sign In for Pricing
View Details
Transferrin (Biotin)
337864-01 50 µg

Transferrin (Biotin)

Sign In for Pricing
View Details