Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNAR1 Peptide - C-terminal region

IFNAR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFNAR1, IFNAR

UniProt

P17181

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNAR1 Rabbit Polyclonal Antibody (orb588054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000620

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Bis(m-tolyloxy)ethane
TRC-M333348-5G 5 g

1,2-Bis(m-tolyloxy)ethane

Sign In for Pricing
View Details
PPP1R14D (NM_017726) Human Recombinant Protein
TP311763M 100 µg

PPP1R14D (NM_017726) Human Recombinant Protein

Sign In for Pricing
View Details
Cd8a Mouse Monoclonal Antibody [Clone ID: 49-31.1]
CL009FX 300 µg

Cd8a Mouse Monoclonal Antibody [Clone ID: 49-31.1]

Sign In for Pricing
View Details
QuantiFluo™ Adenosine Deaminase Assay Kit
DADA-100 100 Tests

QuantiFluo™ Adenosine Deaminase Assay Kit

Sign In for Pricing
View Details
Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)
PKSH032796-01 10 µg

Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)
PKSH032796-02 50 µg

Recombinant Human Neurocalcin-δ/NCALD Protein (His Tag)

Sign In for Pricing
View Details