Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNAR1 Peptide - C-terminal region

IFNAR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFNAR1, IFNAR

UniProt

P17181

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNAR1 Rabbit Polyclonal Antibody (orb588054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000620

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP36 Antibody
KC-1807-01 50 μL

ZFP36 Antibody

Sign In for Pricing
View Details
ZFP36 Antibody
KC-1807-02 100 µL

ZFP36 Antibody

Sign In for Pricing
View Details
ZFP36 Antibody
KC-1807-03 1 mL

ZFP36 Antibody

Sign In for Pricing
View Details
Presenilin 1 / PS-1 Recombinant Rabbit monoclonal Antibody
HA751224 100 µL

Presenilin 1 / PS-1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
beta II TubuLin (TUBB2A) (NM_001069) Human Over-expression Lysate
LY420706 100 µg

beta II TubuLin (TUBB2A) (NM_001069) Human Over-expression Lysate

Sign In for Pricing
View Details
Flt3 / CD135 (FLT3/2458), CF405S conjugate, 0.1mg/mL
BNC042458-500 1x 500 µL

Flt3 / CD135 (FLT3/2458), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details