CDCP1 Peptide - C-terminal region
CDCP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CDCP1, TRASK, UNQ2486/PRO5773
UniProt
Q9H5V8
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDCP1 Rabbit Polyclonal Antibody (orb331430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6178456-01 0.1 mL
DCX (Doublecortin, DBCN, DC, LISX, SCLH, XLIS) (FITC)
Sign In for Pricing
View Details MBS6178456-02 5x 0.1 mL
DCX (Doublecortin, DBCN, DC, LISX, SCLH, XLIS) (FITC)
Sign In for Pricing
View Details MBS1053283-01 0.02 mg (E-Coli)
Recombinant Synechocystis sp. Probable cytosol aminopeptidase (pepA)
Sign In for Pricing
View Details MBS1053283-02 0.02 mg (Yeast)
Recombinant Synechocystis sp. Probable cytosol aminopeptidase (pepA)
Sign In for Pricing
View Details