Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT33A Peptide - C-terminal region

KRT33A Peptide - C-terminal region

Product Specifications

Product Name Alternative

KRT33A, HHA3-I, HKA3A, KRTHA3A

UniProt

O76009

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT33A Rabbit Polyclonal Antibody (orb586841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004129

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NQVLNETRSQYEALVETNRREVEQWFATQTEELNKQVVSSSEQLQSYQAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPNS1 Mouse Monoclonal Antibody [Clone ID: AT1D11]
AM50627PU-N 100 µL

CAPNS1 Mouse Monoclonal Antibody [Clone ID: AT1D11]

Sign In for Pricing
View Details
SR 9009
TRC-S684255-25MG 25 mg

SR 9009

Sign In for Pricing
View Details
PDCD4 Mouse Monoclonal Antibody [Clone ID: k4C1]
AM09026PU-N 100 µL

PDCD4 Mouse Monoclonal Antibody [Clone ID: k4C1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS711454 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Human TMPRSS2 (Transmembrane Protease, Serine 2) CLIA Kit
E-CL-H0915-01 24 Tests

Human TMPRSS2 (Transmembrane Protease, Serine 2) CLIA Kit

Sign In for Pricing
View Details
Human TMPRSS2 (Transmembrane Protease, Serine 2) CLIA Kit
E-CL-H0915-02 48 Tests

Human TMPRSS2 (Transmembrane Protease, Serine 2) CLIA Kit

Sign In for Pricing
View Details