Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBED5 Peptide - N-terminal region

ZBED5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZBED5, Buster1

UniProt

Q49AG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBED5 Rabbit Polyclonal Antibody (orb587807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005253097

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traf5 Mouse Gene Knockout Kit (CRISPR)
KN518128 1 Kit

Traf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIN1 Rabbit Polyclonal Antibody
TA379952 100 µL

PIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Recombinant Protein
TP313132-B 20 µg

HSD17B13 (NM_178135) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710420 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS706204 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Ankrd33 Mouse Gene Knockout Kit (CRISPR)
KN501281 1 Kit

Ankrd33 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details