ZBED5 Peptide - N-terminal region
ZBED5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ZBED5, Buster1
UniProt
Q49AG3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZBED5 Rabbit Polyclonal Antibody (orb587807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005253097
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0950-500 1x 500 µL
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP307432L 1 mg
Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein
Sign In for Pricing
View Details