Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Peptide - middle region

INKA2 Peptide - middle region

Product Specifications

Product Name Alternative

FAM212B, C1orf183

UniProt

Q9NTI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb587301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB513946 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Adenosine 5'-Diphosphate
TRC-A281765-500MG 500 mg

Adenosine 5'-Diphosphate

Sign In for Pricing
View Details
Recombinant ADH5 Antibody
RC-4247-01 50 μL

Recombinant ADH5 Antibody

Sign In for Pricing
View Details
Recombinant ADH5 Antibody
RC-4247-02 100 µL

Recombinant ADH5 Antibody

Sign In for Pricing
View Details
Recombinant ADH5 Antibody
RC-4247-03 1 mL

Recombinant ADH5 Antibody

Sign In for Pricing
View Details
Human ZNF782 activation kit by CRISPRa
GA115962 1 Kit

Human ZNF782 activation kit by CRISPRa

Sign In for Pricing
View Details