INKA2 Peptide - middle region
INKA2 Peptide - middle region
Product Specifications
Product Name Alternative
FAM212B, C1orf183
UniProt
Q9NTI7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb587301) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042831-100 1x 100 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details