Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRIQ3 Peptide - C-terminal region

LRRIQ3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRIQ3, LRRC44

UniProt

A6PVS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRIQ3 Rabbit Polyclonal Antibody (orb587525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099129

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRTFSDIDKYYTEQKKQEYHKEKVRVVAMAQVARERVRVAVNEHLNQKKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS508288 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine-D5 Dihydrochloride
TRC-E925792-5MG 5 mg

11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine-D5 Dihydrochloride

Sign In for Pricing
View Details
PTP1B Recombinant Rabbit Monoclonal Antibody [JJ0935]
ET1701-90 100 µL

PTP1B Recombinant Rabbit Monoclonal Antibody [JJ0935]

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF647 conjugate, 0.1mg/mL
BNC472753-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2753), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5 (6) -ROX Maleimide
#91055 1x 5 mg

5 (6) -ROX Maleimide

Sign In for Pricing
View Details
Mouse Cd69 activation kit by CRISPRa
GA200634 1 Kit

Mouse Cd69 activation kit by CRISPRa

Sign In for Pricing
View Details