Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRIQ3 Peptide - C-terminal region

LRRIQ3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRIQ3, LRRC44

UniProt

A6PVS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRIQ3 Rabbit Polyclonal Antibody (orb587525) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099129

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRTFSDIDKYYTEQKKQEYHKEKVRVVAMAQVARERVRVAVNEHLNQKKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SURF4 Antibody
RC-5513-01 50 μL

Recombinant SURF4 Antibody

Sign In for Pricing
View Details
Recombinant SURF4 Antibody
RC-5513-02 100 µL

Recombinant SURF4 Antibody

Sign In for Pricing
View Details
Recombinant SURF4 Antibody
RC-5513-03 1 mL

Recombinant SURF4 Antibody

Sign In for Pricing
View Details
Twf1 Mouse Gene Knockout Kit (CRISPR)
KN518496 1 Kit

Twf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBLN1 Polyclonal Antibody
E-AB-12407-01 20 µL

FBLN1 Polyclonal Antibody

Sign In for Pricing
View Details
FBLN1 Polyclonal Antibody
E-AB-12407-02 60 µL

FBLN1 Polyclonal Antibody

Sign In for Pricing
View Details