Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKLR Peptide - N-terminal region

PKLR Peptide - N-terminal region

Product Specifications

Product Name Alternative

PKLR, PK1, PKL

UniProt

P30613

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKLR Rabbit Polyclonal Antibody (orb587941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Carbonic Anhydrase 2 Antibody
MBS4509175-01 0.05 mL

Rabbit anti-Carbonic Anhydrase 2 Antibody

Sign In for Pricing
View Details
Rabbit anti-Carbonic Anhydrase 2 Antibody
MBS4509175-02 0.1 mL

Rabbit anti-Carbonic Anhydrase 2 Antibody

Sign In for Pricing
View Details
Rabbit anti-Carbonic Anhydrase 2 Antibody
MBS4509175-03 5x 0.1 mL

Rabbit anti-Carbonic Anhydrase 2 Antibody

Sign In for Pricing
View Details
Pannexin 3 antibody
70R-7072 100 µL

Pannexin 3 antibody

Sign In for Pricing
View Details
Nocardia brasiliensis (ATCC® derived CultiControl)
89189 1 Vial

Nocardia brasiliensis (ATCC® derived CultiControl)

Sign In for Pricing
View Details
Pyrin Antibody [L17B15]
C21935-100uL*2 2x 100μL

Pyrin Antibody [L17B15]

Sign In for Pricing
View Details