Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXTL2 Peptide - C-terminal region

EXTL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=EXTL2

UniProt

Q9UBQ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXTL2 Rabbit Polyclonal Antibody (orb579295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005270678

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Ras-GRF1 (Ser916) Antibody
AF3948-01 100 µL

Phospho-Ras-GRF1 (Ser916) Antibody

Sign In for Pricing
View Details
Phospho-Ras-GRF1 (Ser916) Antibody
AF3948-02 200 µL

Phospho-Ras-GRF1 (Ser916) Antibody

Sign In for Pricing
View Details
Triclocarban-13C6
022169 1 mg

Triclocarban-13C6

Sign In for Pricing
View Details
Ppp1cc sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7599708 1.0 µg DNA

Ppp1cc sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Cntfr ORF Vector (Rat) (pORF)
16510016 1.0 µg DNA

Cntfr ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal HLA DQ/DR/DP Antibody (rHLA-Pan/3475) [Biotin]
NBP3-08644B 100 µL

Mouse Monoclonal HLA DQ/DR/DP Antibody (rHLA-Pan/3475) [Biotin]

Sign In for Pricing
View Details