Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXTL2 Peptide - C-terminal region

EXTL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Name=EXTL2

UniProt

Q9UBQ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXTL2 Rabbit Polyclonal Antibody (orb579295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005270678

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63-α Mouse Monoclonal Antibody (4C12)
E12-768 100 µg -100 µL

P63-α Mouse Monoclonal Antibody (4C12)

Sign In for Pricing
View Details
CLOCK Antibody
A17572-100UL 100 µL

CLOCK Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ASC1 Antibody [Alexa Fluor 647]
NB100-419AF647 0.1 mL

Rabbit Polyclonal ASC1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
4- (3-Oxo-1,4-diazaspiro[4.4]non-2-yl) benzonitrile
OR470232 1 Each

4- (3-Oxo-1,4-diazaspiro[4.4]non-2-yl) benzonitrile

Sign In for Pricing
View Details
C-flat™ 2/2 on 300 gold mesh
X-303-AU300 50 PCS

C-flat™ 2/2 on 300 gold mesh

Sign In for Pricing
View Details
GRGDSPC
TP1759-01 1 mg

GRGDSPC

Sign In for Pricing
View Details