Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPF1 Peptide - N-terminal region

HPF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf27

UniProt

Q9NWY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPF1 Rabbit Polyclonal Antibody (orb587077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060337

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL10AP6 sgRNA CRISPR Lentivector (Human) (Target 3)
K1899104 1.0 µg DNA

RPL10AP6 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SMTN Protein Vector (Mouse) (pPB-N-His)
PV232099 500 ng

SMTN Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Protein hfq (hfq)
MBS1457423-01 0.02 mg (E-Coli)

Recombinant Thermotoga maritima Protein hfq (hfq)

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Protein hfq (hfq)
MBS1457423-02 0.1 mg (E-Coli)

Recombinant Thermotoga maritima Protein hfq (hfq)

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Protein hfq (hfq)
MBS1457423-03 0.02 mg (Yeast)

Recombinant Thermotoga maritima Protein hfq (hfq)

Sign In for Pricing
View Details
Recombinant Thermotoga maritima Protein hfq (hfq)
MBS1457423-04 0.1 mg (Yeast)

Recombinant Thermotoga maritima Protein hfq (hfq)

Sign In for Pricing
View Details