Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM6 Peptide - middle region

MCM6 Peptide - middle region

Product Specifications

Product Name Alternative

MCM6

UniProt

Q14566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCM6 Rabbit Polyclonal Antibody (orb576050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP41 Antibody
8C15042-AAT 50 µg

CEP41 Antibody

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF568 conjugate, 0.1mg/mL
BNC682095-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BDNF Rabbit Polyclonal Antibody
AP23288PU-N 100 µg

BDNF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTSF Antibody
KC-8228-01 50 μL

CTSF Antibody

Sign In for Pricing
View Details
CTSF Antibody
KC-8228-02 100 µL

CTSF Antibody

Sign In for Pricing
View Details
CTSF Antibody
KC-8228-03 1 mL

CTSF Antibody

Sign In for Pricing
View Details