Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM6 Peptide - middle region

MCM6 Peptide - middle region

Product Specifications

Product Name Alternative

MCM6

UniProt

Q14566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCM6 Rabbit Polyclonal Antibody (orb576050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF395 Rabbit Polyclonal Antibody
AP11827PU-N 400 µL

ZNF395 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Blood Bank Refrigerated Centrifuge BBRC-101
BBRC-101 1 Unit

Blood Bank Refrigerated Centrifuge BBRC-101

Sign In for Pricing
View Details
Human PRODH2 activation kit by CRISPRa
GA111790 1 Kit

Human PRODH2 activation kit by CRISPRa

Sign In for Pricing
View Details
(+)-Limonene 2,3,3,5,5,-d5 (Major)
TRC-L461743-5MG 5 mg

(+)-Limonene 2,3,3,5,5,-d5 (Major)

Sign In for Pricing
View Details
Cobicistat-d8
TRC-C633152-25MG 25 mg

Cobicistat-d8

Sign In for Pricing
View Details
BSPH1 (NM_001128326) Human Over-expression Lysate
LY426950 100 µg

BSPH1 (NM_001128326) Human Over-expression Lysate

Sign In for Pricing
View Details