Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHB7 Peptide - middle region

PCDHB7 Peptide - middle region

Product Specifications

Product Name Alternative

PCDHB7

UniProt

Q9Y5E2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHB7 Rabbit Polyclonal Antibody (orb580717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061763

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YAFSYATERILKTFQINPTSGSLHLKAQLDYEAIQTYTLTIQAKDGGGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein J, Human Plasma
APOJ15-N-10 10 µg

Apolipoprotein J, Human Plasma

Sign In for Pricing
View Details
Mouse Mir146 qPCR Primer Pair
QM73654S 200 Tests

Mouse Mir146 qPCR Primer Pair

Sign In for Pricing
View Details
Myosin Phosphatase 2 (PPP1R12B) CytoSection
TS417905P5 25 Slides

Myosin Phosphatase 2 (PPP1R12B) CytoSection

Sign In for Pricing
View Details
PEGFP-N1-Flag-ASH1
PPL50076-2a 1 Each

PEGFP-N1-Flag-ASH1

Sign In for Pricing
View Details
ARMC8 Polyclonal Conjugated Antibody
orb1625331 100 µL

ARMC8 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CXCL11 Rabbit Polyclonal Antibody (FITC)
orb13913 100 µL

CXCL11 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details