Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHB7 Peptide - middle region

PCDHB7 Peptide - middle region

Product Specifications

Product Name Alternative

PCDHB7

UniProt

Q9Y5E2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDHB7 Rabbit Polyclonal Antibody (orb580717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061763

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YAFSYATERILKTFQINPTSGSLHLKAQLDYEAIQTYTLTIQAKDGGGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccnd3 (NM_007632) Mouse Tagged ORF Clone
MR204013 10 µg

Ccnd3 (NM_007632) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
4-O-α-D-Glucopyranosyl-β-D-glucopyranose-1-octadecanoate
sc-490385 250 mg

4-O-α-D-Glucopyranosyl-β-D-glucopyranose-1-octadecanoate

Sign In for Pricing
View Details
Recombinant Human SEPTIN8 Protein
E30P66147B 50 µg

Recombinant Human SEPTIN8 Protein

Sign In for Pricing
View Details
OPLAH Recombinant Protein Antigen
NBP2-47346PEP 0.1 mL

OPLAH Recombinant Protein Antigen

Sign In for Pricing
View Details
PDIA2 Antibody - N-terminal region : FITC (ARP66906_P050-FITC)
ARP66906_P050-FITC 100 µL

PDIA2 Antibody - N-terminal region : FITC (ARP66906_P050-FITC)

Sign In for Pricing
View Details
Recombinant Streptomyces griseus Polyphosphate kinase (ppk), partial
MBS1378990 Inquire

Recombinant Streptomyces griseus Polyphosphate kinase (ppk), partial

Sign In for Pricing
View Details