Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP3 Peptide - C-terminal region

GBP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GBP3

UniProt

Q9H0R5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBP3 Rabbit Polyclonal Antibody (orb585245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILTEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTG4 Rabbit Polyclonal Antibody
TA368762 100 µL

BTG4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), Biotin conjugate, 0.1mg/mL
BNCB1482-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(E)-3-(2-Fluorophenyl)-N-((S)-1-(3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]acrylamide
TRC-F595708-5MG 5 mg

(E)-3-(2-Fluorophenyl)-N-((S)-1-(3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]acrylamide

Sign In for Pricing
View Details
5,10,15-Triphenylcorrole
TRC-B588703-50MG 50 mg

5,10,15-Triphenylcorrole

Sign In for Pricing
View Details
Recombinant TEAD4 Antibody
RC-4835-01 50 μL

Recombinant TEAD4 Antibody

Sign In for Pricing
View Details
Recombinant TEAD4 Antibody
RC-4835-02 100 µL

Recombinant TEAD4 Antibody

Sign In for Pricing
View Details