GBP3 Peptide - C-terminal region
GBP3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GBP3
UniProt
Q9H0R5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GBP3 Rabbit Polyclonal Antibody (orb585245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILTEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY421539 100 µg
Fukutin (FKTN) (NM_001079802) Human Over-expression Lysate
Sign In for Pricing
View Details ![p16INK4A (CDKN2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1c819/imageurl/ta805241bm.webp)
TA805241BM 100 µL
p16INK4A (CDKN2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]
Sign In for Pricing
View Details 
#31068 1 Kit
AccuGreenTM High Sensitivity dsDNA Quantitation Solution (500 assays)
Sign In for Pricing
View Details 