Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1 Peptide - C-terminal region

HIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIP1

UniProt

O00291

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1 Rabbit Polyclonal Antibody (orb585707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005329

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKR Peptide
MBS152385-01 0.05 mg

PKR Peptide

Sign In for Pricing
View Details
PKR Peptide
MBS152385-02 5x 0.05 mg

PKR Peptide

Sign In for Pricing
View Details
Recombinant Mouse HAO1
MBS7611682-01 0.05 mg

Recombinant Mouse HAO1

Sign In for Pricing
View Details
Recombinant Mouse HAO1
MBS7611682-02 0.2 mg

Recombinant Mouse HAO1

Sign In for Pricing
View Details
Recombinant Mouse HAO1
MBS7611682-03 1 mg

Recombinant Mouse HAO1

Sign In for Pricing
View Details
Recombinant Mouse HAO1
MBS7611682-04 5x 1 mg

Recombinant Mouse HAO1

Sign In for Pricing
View Details