Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM12 Peptide - C-terminal region

PRDM12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PFM9, HSAN8

UniProt

Q9H4Q4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM12 Rabbit Polyclonal Antibody (orb324466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067632

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitronectin Receptor / CD51 / CD61 (23C6), Biotin conjugate, 0.1mg/mL
BNCB1471-100 1x 100 µL

Vitronectin Receptor / CD51 / CD61 (23C6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prelid3b Mouse Gene Knockout Kit (CRISPR)
KN516258 1 Kit

Prelid3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ENOX1 (NM_001127615) Human Over-expression Lysate
LY426824 100 µg

ENOX1 (NM_001127615) Human Over-expression Lysate

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF640R conjugate, 0.1mg/mL
BNC402397-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human KIAA0101/p15/PAF Protein (His Tag)
PKSH031315 50 µg

Recombinant Human KIAA0101/p15/PAF Protein (His Tag)

Sign In for Pricing
View Details
cis-Zeatin-9-glucoside (cZ9G)
TRC-Z273045-50MG 50 mg

cis-Zeatin-9-glucoside (cZ9G)

Sign In for Pricing
View Details