Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL50 Peptide - N-terminal region

MRPL50 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRP-L50

UniProt

Q8N5N7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL50 Rabbit Polyclonal Antibody (orb583521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061924

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5 Lipoxygenase Rabbit Polyclonal Antibody
R1512-14 100 µL

5 Lipoxygenase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bottle-top Dispenser with 38, 45, 33mm adapter
LS-900 1 Dispenser

Bottle-top Dispenser with 38, 45, 33mm adapter

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF594 conjugate, 0.1mg/mL
BNC942923-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRYBB3 (NM_004076) Human Over-expression Lysate
LY418242 100 µg

CRYBB3 (NM_004076) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PLCG1 Antibody
RC-16400-01 50 μL

Recombinant PLCG1 Antibody

Sign In for Pricing
View Details
Recombinant PLCG1 Antibody
RC-16400-02 100 µL

Recombinant PLCG1 Antibody

Sign In for Pricing
View Details