Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHSY1 Peptide - C-terminal region

CHSY1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHSY, CSS1, TPBS, ChSy-1

UniProt

Q86X52

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHSY1 Rabbit Polyclonal Antibody (orb327234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055733

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSKSSNNNGSVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r195 Mouse Gene Knockout Kit (CRISPR)
KN518986 1 Kit

Vmn1r195 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRIQ3 (NM_001105659) Human Over-expression Lysate
LC426292 20 µg

LRRIQ3 (NM_001105659) Human Over-expression Lysate

Sign In for Pricing
View Details
PRMT5 Mouse Monoclonal Antibody [Clone ID: OTI3E6]
CF807620 100 µg

PRMT5 Mouse Monoclonal Antibody [Clone ID: OTI3E6]

Sign In for Pricing
View Details
IL12A Antibody
KC-466-01 50 μL

IL12A Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-466-02 100 µL

IL12A Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-466-03 1 mL

IL12A Antibody

Sign In for Pricing
View Details