Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHSY1 Peptide - C-terminal region

CHSY1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHSY, CSS1, TPBS, ChSy-1

UniProt

Q86X52

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHSY1 Rabbit Polyclonal Antibody (orb327234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055733

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSKSSNNNGSVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZASP activation kit by CRISPRa
GA119475 1 Kit

Human ZASP activation kit by CRISPRa

Sign In for Pricing
View Details
GPR32 Human Gene Knockout Kit (CRISPR)
KN209670 1 Kit

GPR32 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Syntaxin 2 (STX2) (NM_001980) Human Over-expression Lysate
LC419613 20 µg

Syntaxin 2 (STX2) (NM_001980) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf130 (NCMAP) Human Gene Knockout Kit (CRISPR)
KN421481 1 Kit

C1orf130 (NCMAP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Crygf (NM_027010) Mouse Tagged ORF Clone
MG201513 10 µg

Crygf (NM_027010) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF740 conjugate, 0.1mg/mL
BNC743124-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details