Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLRB Peptide - N-terminal region

GLRB Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLRB

UniProt

P48167

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLRB Rabbit Polyclonal Antibody (orb575344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MspI, 1000U
RE1302 1000 U

MspI, 1000U

Sign In for Pricing
View Details
9,10-Dibromoanthracene-2-sulfonic Acid
TRC-D423010-500MG 500 mg

9,10-Dibromoanthracene-2-sulfonic Acid

Sign In for Pricing
View Details
BDKRB2 Human Gene Knockout Kit (CRISPR)
KN210378 1 Kit

BDKRB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PYK2 (PTK2B) Human Gene Knockout Kit (CRISPR)
KN203808RB 1 Kit

PYK2 (PTK2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: rectosigmoid
CP629953 150 µg

Tissue Protein Lysate, Colon: rectosigmoid

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), 0.2mg/mL
BNUB2179-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), 0.2mg/mL

Sign In for Pricing
View Details