Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLRB Peptide - N-terminal region

GLRB Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLRB

UniProt

P48167

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLRB Rabbit Polyclonal Antibody (orb575344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gamma Catenin (JUP) (NM_002230) Human Over-expression Lysate
LC400807 20 µg

gamma Catenin (JUP) (NM_002230) Human Over-expression Lysate

Sign In for Pricing
View Details
rac 3-Hydroxybutyric Acid-d2 Sodium Salt
TRC-H833023-10MG 10 mg

rac 3-Hydroxybutyric Acid-d2 Sodium Salt

Sign In for Pricing
View Details
GNAT2 Polyclonal Antibody
E-AB-90138-01 60 µL

GNAT2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT2 Polyclonal Antibody
E-AB-90138-02 120 µL

GNAT2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT2 Polyclonal Antibody
E-AB-90138-03 200 µL

GNAT2 Polyclonal Antibody

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF405S conjugate, 0.1mg/mL
BNC041887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details