Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL13A1 Peptide - C-terminal region

COL13A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMS19, COLXIIIA1

UniProt

Q5TAT6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL13A1 Rabbit Polyclonal Antibody (orb327235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf181 (NM_207442) Human Over-expression Lysate
LC404036 20 µg

C14orf181 (NM_207442) Human Over-expression Lysate

Sign In for Pricing
View Details
STARD5 (N-term) Rabbit Polyclonal Antibody
AP54068PU-N 400 µL

STARD5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAMKIV (CAMK4) Rabbit Polyclonal Antibody
TA362804 100 µL

CAMKIV (CAMK4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC19 (NM_017775) Human Recombinant Protein
TP311271 20 µg

TTC19 (NM_017775) Human Recombinant Protein

Sign In for Pricing
View Details
Prolactin Receptor (PRLR/742), CF647 conjugate, 0.1mg/mL
BNC470742-500 1x 500 µL

Prolactin Receptor (PRLR/742), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human AMH protein (His tag)
PDEH100780-01 20 µg

Recombinant Human AMH protein (His tag)

Sign In for Pricing
View Details