Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL13A1 Peptide - C-terminal region

COL13A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMS19, COLXIIIA1

UniProt

Q5TAT6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL13A1 Rabbit Polyclonal Antibody (orb327235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR561214 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
MOV10L1 Human Gene Knockout Kit (CRISPR)
KN419511 1 Kit

MOV10L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF154 Human Gene Knockout Kit (CRISPR)
KN419041 1 Kit

ZNF154 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ICAM1 Recombinant Rabbit Monoclonal Antibody [ST0487]
ET1609-46 100 µL

ICAM1 Recombinant Rabbit Monoclonal Antibody [ST0487]

Sign In for Pricing
View Details
CD2 Human Gene Knockout Kit (CRISPR)
KN206612LP 1 Kit

CD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Endophenazine A
TRC-E555480-1MG 1 mg

Endophenazine A

Sign In for Pricing
View Details