IRAK4 Peptide - N-terminal region
IRAK4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IRAK4
UniProt
Q9NWZ3
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IRAK4 Rabbit Polyclonal Antibody (orb588129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E596072-100MG 100 mg
Erdosteine Homocysteine Impurity Sodium Salt
Sign In for Pricing
View Details 
![Caspr2 (CNTNAP2) Mouse Monoclonal Antibody [Clone ID: K67/25]](https://cdn.genprice.uk/products/937/68dd1898061270361e8fb3a1/imageurl/75-075.webp)
75-075 100 µL
Caspr2 (CNTNAP2) Mouse Monoclonal Antibody [Clone ID: K67/25]
Sign In for Pricing
View Details 
![ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd228/imageurl/am31187fc-n.webp)
AM31187FC-N 1 mL (100 Tests)
ICAM1 Mouse Monoclonal Antibody [Clone ID: B-H17]
Sign In for Pricing
View Details 
BNUB3807-500 1x 500 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), 0.2mg/mL
Sign In for Pricing
View Details