IRAK4 Peptide - N-terminal region
IRAK4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
IRAK4
UniProt
Q9NWZ3
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IRAK4 Rabbit Polyclonal Antibody (orb588129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY427477 100 µg
Nuclear Factor 1 (NFIA) (NM_001134673) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC471592-500 1x 500 µL
Aurora B (Proliferation Marker) (AURKB/1592), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-OSEL-H0069-01 24 Tests
QuicKey Pro Human HO1 (Heme Oxygenase 1) ELISA Kit
Sign In for Pricing
View Details E-OSEL-H0069-02 48 Tests
QuicKey Pro Human HO1 (Heme Oxygenase 1) ELISA Kit
Sign In for Pricing
View Details