SNRPF Peptide - N-terminal region
SNRPF Peptide - N-terminal region
Product Specifications
Product Name Alternative
SMF, Sm-F, snRNP-F
UniProt
P62306
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRPF Rabbit Polyclonal Antibody (orb327280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003086
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880520-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details