ZNF576 Peptide - middle region
ZNF576 Peptide - middle region
Product Specifications
UniProt
Q9H609
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF576 Rabbit Polyclonal Antibody (orb324579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_077303
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
L1585-01B-AP 100 µL
LD78-beta (LD78 beta (1-70), 464.2, Chemokine (CC motif) Ligand 3-like 1, CCL3L1, D17S1718, G0/G1 Switch Regulatory Protein 19-2, G0S19-2, MGC12815, Small Inducible Cytokine A3-like 1 Precursor, SCYA3L1, Tonsillar Lymphocyte LD78 beta) (AP) discontinued
Sign In for Pricing
View Details