Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF576 Peptide - middle region

ZNF576 Peptide - middle region

Product Specifications

UniProt

Q9H609

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF576 Rabbit Polyclonal Antibody (orb324579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077303

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For C-X-C chemokine receptor type 7
E9240d 96 Tests

ELISA Kit For C-X-C chemokine receptor type 7

Sign In for Pricing
View Details
DROSHA Protein Lysate (Mouse) with C-HA Tag
18604035 100 µg

DROSHA Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
C-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: LBI3F2]
AMM08907VCF 100 µg

C-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: LBI3F2]

Sign In for Pricing
View Details
GCH1 Polyclonal Antibody
MBS2518079-01 0.02 mL

GCH1 Polyclonal Antibody

Sign In for Pricing
View Details
GCH1 Polyclonal Antibody
MBS2518079-02 0.06 mL

GCH1 Polyclonal Antibody

Sign In for Pricing
View Details
GCH1 Polyclonal Antibody
MBS2518079-03 0.12 mL

GCH1 Polyclonal Antibody

Sign In for Pricing
View Details