Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B3 Peptide - C-terminal region

SF3B3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SF3B3, KIAA0017, SAP130

UniProt

Q15393

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3B3 Rabbit Polyclonal Antibody (orb588167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036558

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IRE1 alpha Antibody (142) [DyLight 405]
NBP2-90017V 0.1 mL

Rabbit Monoclonal IRE1 alpha Antibody (142) [DyLight 405]

Sign In for Pricing
View Details
Mouse OGT siRNA
abx926815-01 15 nmol

Mouse OGT siRNA

Sign In for Pricing
View Details
Mouse OGT siRNA
abx926815-02 30 nmol

Mouse OGT siRNA

Sign In for Pricing
View Details
Recombinant Rickettsia massiliae tRNA modification GTPase MnmE (mnmE)
MBS1222738-01 0.02 mg (E-Coli)

Recombinant Rickettsia massiliae tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Rickettsia massiliae tRNA modification GTPase MnmE (mnmE)
MBS1222738-02 0.02 mg (Yeast)

Recombinant Rickettsia massiliae tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Rickettsia massiliae tRNA modification GTPase MnmE (mnmE)
MBS1222738-03 0.1 mg (E-Coli)

Recombinant Rickettsia massiliae tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details