SF3B3 Peptide - C-terminal region
SF3B3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SF3B3, KIAA0017, SAP130
UniProt
Q15393
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SF3B3 Rabbit Polyclonal Antibody (orb588167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036558
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126566-AP 100 µL
Factor VIII (Coagulation Factor VIII, FVIII, F8 Protein, F8B, F8C, Antihemophilic Factor, AHF, Dxs1253e, HEMA, Procoagulant Component) (AP) discontinued
Sign In for Pricing
View Details 
SC212659 10 µg
Neurochondrin (NCDN) (NM_001014839) Human 3' UTR Clone
Sign In for Pricing
View Details